Rabbit anti-Human HSP60/HSPD1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12824P

• Product Name:
• Rabbit anti-Human HSP60/HSPD1 Polyclonal Antibody

• Synonym:
• HLD4; CPN60; GROEL; HSP60; HSP65; SPG13; HSP-60; HuCHA60; HSP60/HSPD1

• Description:
• The antibody against HSP60/HSPD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-240 of human HSP60/HSPD1 (NP_002147.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 27-240 of human HSP60/HSPD1 (NP_002147.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HSP60/HSPD1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ

• Gene ID:
• 3329

• Uniprot-ID:
• P10809

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Jurkat, K-562, Mouse kidney, Mouse liver, Mouse thymus, Rat heart