Rabbit anti-Human HSP20/HSPB6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00875P

• Product Name:
• Rabbit anti-Human HSP20/HSPB6 Polyclonal Antibody

• Synonym:
• HEL55; Hsp20; PPP1R91; HSP20/HSPB6

• Description:
• The antibody against HSP20/HSPB6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human HSP20/HSP20/HSPB6 (NP_653218.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human HSP20/HSP20/HSPB6 (NP_653218.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HSP20/HSPB6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK

• Gene ID:
• 126393

• Uniprot-ID:
• O14558

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung