Rabbit anti-Human HP1 gamma/CBX3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-16729P

• Product Name:
• Rabbit anti-Human HP1 gamma/CBX3 Polyclonal Antibody

• Synonym:
• HECH; HP1-GAMMA; HP1Hs-gamma; X3

• Description:
• The antibody against HP1 gamma/CBX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human HP1 gamma/HP1 gamma/CBX3 (NP_009207.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human HP1 gamma/HP1 gamma/CBX3 (NP_009207.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HP1 gamma/CBX3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ

• Gene ID:
• 11335

• Uniprot-ID:
• Q13185

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, MCF-7, 293T, A-549, NCI-H460, Mouse brain, Mouse lung, Mouse spleen