Rabbit anti-Human HOXB5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00031P

• Product Name:
• Rabbit anti-Human HOXB5 Polyclonal Antibody

• Synonym:
• HOX2; HU-1; HOX2A; Hox2.1; HHO.C10; HOXB5

• Description:
• The antibody against HOXB5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-269 of human HOXB5 (NP_002138.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 170-269 of human HOXB5 (NP_002138.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HOXB5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAFQP

• Gene ID:
• 3215

• Uniprot-ID:
• P09067

• Purification Method:
• Affinity purification

• Positive Samples:
• 293F, U-937(negative), Rat lung