Rabbit anti-Human hnRNP A1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12104P

• Product Name:
• Rabbit anti-Human hnRNP A1 Polyclonal Antibody

• Synonym:
• UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1

• Description:
• The antibody against hnRNP A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-372 of human hnRNP A1 (NP_112420.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-372 of human hnRNP A1 (NP_112420.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• hnRNP A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF

• Gene ID:
• 3178

• Uniprot-ID:
• P09651

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, Jurkat, HepG2, HL-60, 293T