Rabbit anti-Human HNF4A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11441P

• Product Name:
• Rabbit anti-Human HNF4A Polyclonal Antibody

• Synonym:
• TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; TCF-14; HNF4alpha; HNF4A

• Description:
• The antibody against HNF4A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 155-254 of human HNF4A (NP_000448.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 155-254 of human HNF4A (NP_000448.3).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HNF4A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRH

• Gene ID:
• 3172

• Uniprot-ID:
• P41235

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse liver