Rabbit anti-Human HNF1α Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11258P

• Product Name:
• Rabbit anti-Human HNF1α Polyclonal Antibody

• Synonym:
• HNF1; LFB1; TCF1; HNF4A; MODY3; TCF-1; HNF-1A; IDDM20; HNF1alpha; HNF-1-alpha; HNF1α

• Description:
• The antibody against HNF1α was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human HNF1α (NP_000536.6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human HNF1α (NP_000536.6).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HNF1α

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LGEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQ

• Gene ID:
• 6927

• Uniprot-ID:
• P20823

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, LO2