• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti-Human Histone H4 Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-14647P
  • Product Name:
  • Rabbit anti-Human Histone H4 Polyclonal Antibody
  • Synonym:
  • H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4FA; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; HIST1H4A; H4
  • Description:
  • The antibody against Histone H4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4 (NP_003529.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4 (NP_003529.1).
  • Species Reactivity:
  • Human, Mouse, Rat, Other (Wide Range Predicted)
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • Histone H4
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
  • Gene ID:
  • 8359
  • Purification Method:
  • Affinity purification
  • Positive Samples:
  • 293T, Hela, NIH/3T3, C6, HCT116, Mouse brain, Rat brain, Rat kidney, Rat spleen
  • Pre product:Rabbit anti-Human SUMO1 Polyclonal Antibody-ADA-14646P
  • Online Inquiry

    refresh