Rabbit anti-Human Histone H3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02746P

• Product Name:
• Rabbit anti-Human Histone H3 Polyclonal Antibody

• Synonym:
• H3/b; H3C1; H3C2; H3C3; H3C6; H3C7; H3C8; H3FB; H3C10; H3C11; H3C12; HIST1H3D; Histone H3

• Description:
• The antibody against Histone H3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human HIST1H3D (NP_003520.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human HIST1H3D (NP_003520.1).

• Species Reactivity:
• Human, Mouse, Rat, Other (Wide Range Predicted)

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Histone H3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

• Gene ID:
• 82908350

• Uniprot-ID:
• Q16695

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, HeLa, Mouse lung