Rabbit anti-Human Histone H2AX Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01589P

• Product Name:
• Rabbit anti-Human Histone H2AX Polyclonal Antibody

• Synonym:
• H2A.X; H2A/X; H2AFX; Histone H2AX

• Description:
• The antibody against Histone H2AX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human Histone H2AX (NP_002096.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human Histone H2AX (NP_002096.1).

• Species Reactivity:
• Human, Mouse, Rat, Other (Wide Range Predicted)

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Histone H2AX

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

• Gene ID:
• 3014

• Uniprot-ID:
• P16104

• Purification Method:
• Affinity purification

• Positive Samples:
• K-562, NIH/3T3, Mouse spleen