Rabbit anti-Human Histone H1.4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10530P

• Product Name:
• Rabbit anti-Human Histone H1.4 Polyclonal Antibody

• Synonym:
• H1E; H1.4; H1F4; RMNS; H1s-4; HIST1H1E; dJ221C16.5; Histone H1.4

• Description:
• The antibody against Histone H1.4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H14 (NP_005312.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H14 (NP_005312.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Histone H1.4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG

• Gene ID:
• 3008

• Uniprot-ID:
• P10412

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse liver, Rat liver