Rabbit anti-Human Histone H1.0 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-15907P

• Product Name:
• Rabbit anti-Human Histone H1.0 Polyclonal Antibody

• Synonym:
• H10; H1.0; H1F0; H1FV; .0

• Description:
• The antibody against Histone H1.0 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human H1F0 (NP_005309.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human H1F0 (NP_005309.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Histone H1.0

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSV

• Gene ID:
• 3005

• Uniprot-ID:
• P07305

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T