Rabbit anti-Human HIF1α Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12846P

• Product Name:
• Rabbit anti-Human HIF1α Polyclonal Antibody

• Synonym:
• HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha; HIF1α

• Description:
• The antibody against HIF1α was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human HIF1α (NP_001521.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human HIF1α (NP_001521.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HIF1α

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTT

• Gene ID:
• 3091

• Uniprot-ID:
• Q16665

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, HepG2