Rabbit anti-Human HIF1β/ARNT Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06875P

• Product Name:
• Rabbit anti-Human HIF1β/ARNT Polyclonal Antibody

• Synonym:
• HIF1B; TANGO; bHLHe2; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta; HIF1β/ARNT

• Description:
• The antibody against HIF1β/ARNT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 465-570 of human HIF1β/ARNT (NP_001659.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 465-570 of human HIF1β/ARNT (NP_001659.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HIF1β/ARNT

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSK

• Gene ID:
• 405

• Uniprot-ID:
• P27540

• Purification Method:
• Affinity purification