Rabbit anti-Human Hexokinase II Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06564P

• Product Name:
• Rabbit anti-Human Hexokinase II Polyclonal Antibody

• Synonym:
• HKII; HXK2; II

• Description:
• The antibody against Hexokinase II was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-120 of human Hexokinase II (NP_000180.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-120 of human Hexokinase II (NP_000180.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Hexokinase II

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR

• Gene ID:
• 3099

• Uniprot-ID:
• P52789

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, SH-SY5Y