Rabbit anti-Human HES5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11545P

• Product Name:
• Rabbit anti-Human HES5 Polyclonal Antibody

• Synonym:
• bHLHb38; HES5

• Description:
• The antibody against HES5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-100 of human HES5 (NP_001010926.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 40-100 of human HES5 (NP_001010926.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HES5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAV

• Gene ID:
• 388585

• Uniprot-ID:
• Q5TA89

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain