Rabbit anti-Human Hemopexin (HPX) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09670P

• Product Name:
• Rabbit anti-Human Hemopexin (HPX) Polyclonal Antibody

• Synonym:
• HX; Hemopexin (HPX)

• Description:
• The antibody against Hemopexin (HPX) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-245 of human Hemopexin (Hemopexin (HPX)) (NP_000604.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-245 of human Hemopexin (Hemopexin (HPX)) (NP_000604.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Hemopexin (HPX)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHG

• Gene ID:
• 3263

• Uniprot-ID:
• P02790

• Purification Method:
• Affinity purification

• Positive Samples:
• HL-60, HepG2, BT-474, Mouse liver, Mouse pancreas