Rabbit anti-Human HDAC4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08395P

• Product Name:
• Rabbit anti-Human HDAC4 Polyclonal Antibody

• Synonym:
• HDAC4; AHO3; BDMR; HA6116; HD4; HDAC-4; HDAC-A; HDACA; histone deacetylase 4

• Description:
• The antibody against HDAC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-160 of human HDAC4 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 62-160 of human HDAC4.

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HDAC4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEK

• Gene ID:
• 9759

• Uniprot-ID:
• P56524

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat, U-2 OS, C2C12