Rabbit anti-Human HDAC3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08735P

• Product Name:
• Rabbit anti-Human HDAC3 Polyclonal Antibody

• Synonym:
• HD3; RPD3; KDAC3; RPD3-2; HDAC3

• Description:
• The antibody against HDAC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 329-428 of human HDAC3 (NP_003874.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 329-428 of human HDAC3 (NP_003874.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HDAC3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

• Gene ID:
• 8841

• Uniprot-ID:
• O15379

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, K-562, NIH/3T3, Mouse brain, Mouse spleen, Rat kidney