Rabbit anti-Human HCLS1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04394P

• Product Name:
• Rabbit anti-Human HCLS1 Polyclonal Antibody

• Synonym:
• HS1; p75; CTTNL; lckBP1; HCLS1

• Description:
• The antibody against HCLS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human HCLS1 (NP_005326.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human HCLS1 (NP_005326.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HCLS1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQ

• Gene ID:
• 3059

• Uniprot-ID:
• P14317

• Purification Method:
• Affinity purification

• Positive Samples:
• BT-474, Jurkat