Rabbit anti-Human HCAR3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06403P

• Product Name:
• Rabbit anti-Human HCAR3 Polyclonal Antibody

• Synonym:
• HCA3; HM74; PUMAG; Puma-g; GPR109B; HCAR3

• Description:
• The antibody against HCAR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-392 of human HCAR3 (NP_006009.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 300-392 of human HCAR3 (NP_006009.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HCAR3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE

• Gene ID:
• 8843

• Uniprot-ID:
• P49019

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat pancreas