Rabbit anti-Human HBB Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09607P

• Product Name:
• Rabbit anti-Human HBB Polyclonal Antibody

• Synonym:
• ECYT6; CD113t-C; beta-globin; HBB

• Description:
• The antibody against HBB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 47-147 of human HBB (NP_000509.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 47-147 of human HBB (NP_000509.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HBB

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

• Gene ID:
• 3043

• Uniprot-ID:
• P68871

• Purification Method:
• Affinity purification

• Positive Samples:
• Raji