Rabbit anti-Human Guanylyl Cyclase beta 1 (GUCY1B3) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10115P

• Product Name:
• Rabbit anti-Human Guanylyl Cyclase beta 1 (GUCY1B3) Polyclonal Antibody

• Synonym:
• GUCB3; GC-SB3; GUC1B3; GUCSB3; GUCY1B3; GC-S-beta-1; Guanylyl Cyclase beta 1 (GUCY1B3)

• Description:
• The antibody against Guanylyl Cyclase beta 1 (GUCY1B3) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Guanylyl Cyclase beta 1 (Guanylyl Cyclase beta 1 (GUCY1B3)) (NP_000848.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Guanylyl Cyclase beta 1 (Guanylyl Cyclase beta 1 (GUCY1B3)) (NP_000848.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Guanylyl Cyclase beta 1 (GUCY1B3)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSL

• Gene ID:
• 2983

• Uniprot-ID:
• Q02153

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain, Rat lung, Rat brain