Rabbit anti-Human GTF2IRD1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08252P

• Product Name:
• Rabbit anti-Human GTF2IRD1 Polyclonal Antibody

• Synonym:
• GTF2IRD1; BEN; CREAM1; GTF3; MUSTRD1; RBAP2; WBS; WBSCR11; WBSCR12; hMusTRD1alpha1; GTF2I repeat domain containing 1

• Description:
• The antibody against GTF2IRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 660-890 of human GTF2IRD1 (NP_057412.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 660-890 of human GTF2IRD1 (NP_057412.1).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GTF2IRD1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SLGFSPPALPPERDSGDPLVDESLKRQGFQENYDARLSRIDIANTLREQVQDLFNKKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRKPCTFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKVILREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVIINQLQPFAEICNDAKV

• Gene ID:
• 9569

• Uniprot-ID:
• Q9UHL9

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat liver