Rabbit anti-Human GTF2H2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03834P

• Product Name:
• Rabbit anti-Human GTF2H2 Polyclonal Antibody

• Synonym:
• p44; BTF2; TFIIH; BTF2P44; BTF2 p44; T-BTF2P44; GTF2H2

• Description:
• The antibody against GTF2H2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GTF2H2 (NP_001506.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GTF2H2 (NP_001506.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GTF2H2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNP

• Gene ID:
• 2966

• Uniprot-ID:
• Q13888

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse kidney, Mouse thymus, Rat testis