Rabbit anti-Human Grp94 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12285P

• Product Name:
• Rabbit anti-Human Grp94 Polyclonal Antibody

• Synonym:
• ECGP; GP96; TRA1; GRP94; HEL35; HEL-S-125m; Grp94

• Description:
• The antibody against Grp94 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-310 of human Grp94 (NP_003290.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 40-310 of human Grp94 (NP_003290.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Grp94

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEESDDEA

• Gene ID:
• 7184

• Uniprot-ID:
• P14625

• Purification Method:
• Affinity purification

• Positive Samples:
• A375, HeLa, LO2, NIH/3T3, Mouse liver