Rabbit anti-Human GPR62 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04592P

• Product Name:
• Rabbit anti-Human GPR62 Polyclonal Antibody

• Synonym:
• GPCR8; KPG_005; GPR62

• Description:
• The antibody against GPR62 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR62 (NP_543141.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR62 (NP_543141.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GPR62

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GTPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYGGIFVVARRAALRPPRPARGSRLHSDSLDSRLSILPPLRPRLPGGKAALAPALAVGQF

• Gene ID:
• 118442

• Uniprot-ID:
• Q9BZJ7

• Purification Method:
• Affinity purification

• Positive Samples:
• SH-SY5Y