Rabbit anti-Human GP6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10151P

• Product Name:
• Rabbit anti-Human GP6 Polyclonal Antibody

• Synonym:
• GPIV; GPVI; BDPLT11; GP6

• Description:
• The antibody against GP6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 21-267 of human GP6 (NP_057447.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 21-267 of human GP6 (NP_057447.5).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GP6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTK

• Gene ID:
• 51206

• Uniprot-ID:
• Q9HCN6

• Purification Method:
• Affinity purification

• Positive Samples:
• K-562, HEL, Mouse testis, Rat testis