Rabbit anti-Human GLRB Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01606P

• Product Name:
• Rabbit anti-Human GLRB Polyclonal Antibody

• Synonym:
• HKPX2; GLRB

• Description:
• The antibody against GLRB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-265 of human GLRB (NP_000815.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 23-265 of human GLRB (NP_000815.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GLRB

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQ

• Gene ID:
• 2743

• Uniprot-ID:
• P48167

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG, NCI-H460, HT-1080, THP-1, Mouse brain, Mouse liver, Mouse eye, Rat brain, Rat liver