Rabbit anti-Human GGT1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04507P

• Product Name:
• Rabbit anti-Human GGT1 Polyclonal Antibody

• Synonym:
• GGT; GTG; GGTD; CD224; GGT 1; D22S672; D22S732; GGT1

• Description:
• The antibody against GGT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 370-569 of human GGT1 (NP_038265.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 370-569 of human GGT1 (NP_038265.2?).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GGT1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY

• Gene ID:
• 2678

• Uniprot-ID:
• P19440

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat, Mouse kidney