Rabbit anti-Human GDI2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-15830P

• Product Name:
• Rabbit anti-Human GDI2 Polyclonal Antibody

• Synonym:
• RABGDIB; HEL-S-46e; I2

• Description:
• The antibody against GDI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 296-445 of human GDI2 (NP_001485.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 296-445 of human GDI2 (NP_001485.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GDI2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

• Gene ID:
• 2665

• Uniprot-ID:
• P50395

• Purification Method:
• Affinity purification

• Positive Samples:
• HT-29, A-549, HepG2, U-87MG, Mouse spleen, Mouse kidney, Mouse lung, Rat liver, Rat spinal cord