Rabbit anti-Human GC1q R/C1QBP Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12007P

• Product Name:
• Rabbit anti-Human GC1q R/C1QBP Polyclonal Antibody

• Synonym:
• p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R; COXPD33; SF2AP32; GC1q R/C1QBP

• Description:
• The antibody against GC1q R/C1QBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 74-282 of human GC1q R/GC1q R/C1QBP (NP_001203.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 74-282 of human GC1q R/GC1q R/C1QBP (NP_001203.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GC1q R/C1QBP

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

• Gene ID:
• 708

• Uniprot-ID:
• Q07021

• Purification Method:
• Affinity purification

• Positive Samples:
• CEM, SW620, HeLa, Jurkat, Mouse liver, Mouse kidney, Mouse heart, Mouse intestine, Rat brain