Rabbit anti-Human GATAD2B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00940P

• Product Name:
• Rabbit anti-Human GATAD2B Polyclonal Antibody

• Synonym:
• p68; GANDS; MRD18; P66beta; GATAD2B

• Description:
• The antibody against GATAD2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human GATAD2B (NP_065750.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human GATAD2B (NP_065750.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GATAD2B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLT

• Gene ID:
• 57459

• Uniprot-ID:
• Q8WXI9

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG, LO2, HeLa, Jurkat, Mouse brain, Mouse kidney, Rat thymus