Rabbit anti-Human GAP43 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09739P

• Product Name:
• Rabbit anti-Human GAP43 Polyclonal Antibody

• Synonym:
• B-50; PP46; GAP-43; GAP43

• Description:
• The antibody against GAP43 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-238 of human GAP43 (NP_002036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-238 of human GAP43 (NP_002036.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GAP43

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

• Gene ID:
• 2596

• Uniprot-ID:
• P17677

• Purification Method:
• Affinity purification

• Positive Samples:
• mouse brain, rat brain