Rabbit anti-Human Galectin 8/LGALS8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05884P

• Product Name:
• Rabbit anti-Human Galectin 8/LGALS8 Polyclonal Antibody

• Synonym:
• Gal-8; PCTA1; PCTA-1; Po66-CBP; Galectin 8/LGALS8

• Description:
• The antibody against Galectin 8/LGALS8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-317 of human Galectin 8/Galectin 8/LGALS8 (NP_963838.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-317 of human Galectin 8/Galectin 8/LGALS8 (NP_963838.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Galectin 8/LGALS8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

• Gene ID:
• 3964

• Uniprot-ID:
• O00214

• Purification Method:
• Affinity purification