Rabbit anti-Human GALE Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02936P

• Product Name:
• Rabbit anti-Human GALE Polyclonal Antibody

• Synonym:
• SDR1E1; GALE

• Description:
• The antibody against GALE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 129-348 of human GALE (NP_001121093.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 129-348 of human GALE (NP_001121093.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GALE

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA

• Gene ID:
• 2582

• Uniprot-ID:
• Q14376

• Purification Method:
• Affinity purification

• Positive Samples:
• SW480, SKOV3, HepG2, U-251MG, HeLa, Mouse liver, Rat liver