Rabbit anti-Human G2E3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05659P

• Product Name:
• Rabbit anti-Human G2E3 Polyclonal Antibody

• Synonym:
• PHF7B; KIAA1333; G2E3

• Description:
• The antibody against G2E3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human G2E3 (NP_060239.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human G2E3 (NP_060239.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• G2E3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNFASFCWDHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI

• Gene ID:
• 55632

• Uniprot-ID:
• Q7L622

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, LO2, 293T, OVCAR3, Mouse eye, Mouse brain, Mouse liver, Rat testis