Rabbit anti-Human Furin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00303P

• Product Name:
• Rabbit anti-Human Furin Polyclonal Antibody

• Synonym:
• FUR; PACE; SPC1; PCSK3; Furin

• Description:
• The antibody against Furin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-794 of human Furin (NP_002560.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 700-794 of human Furin (NP_002560.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Furin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AGQRLRAGLLPSHLPEVVAGLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSAL

• Gene ID:
• 5045

• Uniprot-ID:
• P09958

• Purification Method:
• Affinity purification