Rabbit anti-Human FOXJ1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08047P

• Product Name:
• Rabbit anti-Human FOXJ1 Polyclonal Antibody

• Synonym:
• HFH4; HFH-4; CILD43; FKHL13; FOXJ1

• Description:
• The antibody against FOXJ1 was raised in Rabbit using the recombinant protein of human FOXJ1 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human FOXJ1.

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FOXJ1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DTLWQCPSSPWEKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDLDDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKG

• Gene ID:
• 2302

• Uniprot-ID:
• Q92949

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain,