Rabbit anti-Human FGFR2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09908P

• Product Name:
• Rabbit anti-Human FGFR2 Polyclonal Antibody

• Synonym:
• BEK; JWS; BBDS; CEK3; CFD1; ECT1; KGFR; TK14; TK25; BFR-1; CD332; K-SAM; FGFR2

• Description:
• The antibody against FGFR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGFR2 (NP_000132.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGFR2 (NP_000132.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FGFR2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPR

• Gene ID:
• 2263

• Uniprot-ID:
• P21802

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, LO2