Rabbit anti-Human FCGR2B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06333P

• Product Name:
• Rabbit anti-Human FCGR2B Polyclonal Antibody

• Synonym:
• CD32; FCG2; CD32B; FCGR2; IGFR2; FCGR2C; FcGRIIB; FcRII-c; FcgammaRIIb; FCGR2B

• Description:
• The antibody against FCGR2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 43-217 of human FCGR2B (NP_003992.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 43-217 of human FCGR2B (NP_003992.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FCGR2B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP

• Gene ID:
• 2213

• Uniprot-ID:
• P31994

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse spleen, Rat liver