Rabbit anti-Human FCER1G Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11142P

• Product Name:
• Rabbit anti-Human FCER1G Polyclonal Antibody

• Synonym:
• FCRG; FCER1G

• Description:
• The antibody against FCER1G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FCER1G

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

• Gene ID:
• 2207

• Uniprot-ID:
• P30273

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse spleen