Rabbit anti-Human FBXO33 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05733P

• Product Name:
• Rabbit anti-Human FBXO33 Polyclonal Antibody

• Synonym:
• Fbx33; BMND12; c14_5247; FBXO33

• Description:
• The antibody against FBXO33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 346-555 of human FBXO33 (NP_976046.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 346-555 of human FBXO33 (NP_976046.1).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FBXO33

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VMHKSLDNMPNDEHWKALSRKSTSFRVYIMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDKFLTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARLRGSDLKVLEVTEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPWHAVMDIESLSVFTEPNRHFYREMQSFSEDI

• Gene ID:
• 254170

• Uniprot-ID:
• Q7Z6M2

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat brain, Rat testis