Rabbit anti-Human Fascin/FSCN1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-16708P

• Product Name:
• Rabbit anti-Human Fascin/FSCN1 Polyclonal Antibody

• Synonym:
• HSN; SNL; p55; FAN1; N1

• Description:
• The antibody against Fascin/FSCN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 394-493 of human Fascin/Fascin/FSCN1 (NP_003079.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 394-493 of human Fascin/Fascin/FSCN1 (NP_003079.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Fascin/FSCN1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FIGCRKVTGTLDANRSSYDVFQLEFNDGAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDPASLWEY

• Gene ID:
• 6624

• Uniprot-ID:
• Q16658

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG, HeLa, NCI-H460, HepG2, SH-SY5Y, Mouse brain, Mouse spinal cord