Rabbit anti-Human FAM234A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00192P

• Product Name:
• Rabbit anti-Human FAM234A Polyclonal Antibody

• Synonym:
• gs19; ITFG3; C16orf9; FAM234A

• Description:
• The antibody against FAM234A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-400 of human FAM234A (NP_114428.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 70-400 of human FAM234A (NP_114428.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FAM234A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IPCPDRPASQRMWRIDYSAAVIYDFLAVDDINGDRIQDVLFLYKNTNSSNNFSRSCVDEGFSSPCTFAAAVSGANGSTLWERPVAQDVALVECAVPQPRGSEAPSACILVGRPSSFIAVNLFTGETLWNHSSSFSGNASILSPLLQVPDVDGDGAPDLLVLTQEREEVSGHLYSGSTGHQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGSGGPFKSDPHWESMLNATTRRMLSHSSGAVRYLMHVPGNAGADVLLVGSEAFVLLDGQELTPRWTPKAAHVLRKPIFGRYKPDTLAVAVENGTGTDRQILFL

• Gene ID:
• 83986

• Uniprot-ID:
• Q9H0X4

• Purification Method:
• Affinity purification

• Positive Samples:
• SGC-7901, HepG2, OVCAR3