Rabbit anti-Human FAM160B2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00709P

• Product Name:
• Rabbit anti-Human FAM160B2 Polyclonal Antibody

• Synonym:
• FAI16; RAI16; FAM160B2; RAM160B2

• Description:
• The antibody against FAM160B2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 74-303 of human FAM160B2 (NP_073586.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 74-303 of human FAM160B2 (NP_073586.5).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FAM160B2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GEAGPCLEYLLQHKILETLCTLGKAEYPPGMRQQVFQFFSKVLAQVQHPLLHYLSVHRPVQKLLRLGGTASGSVTEKEEVQFTTVLCSKIQQDPELLAYILEGKKIVGRKKACGEPTALPKDTTSHGDKDCSHDGAPARPQLDGESCGAQALNSHMPAETEELDGGTTESNLITSLLGLCQSKKSRVALKAQENLLLLVSMASPAAATYLVQSSACCPAIVRHLCQLYRS

• Gene ID:
• 64760

• Uniprot-ID:
• Q86V87

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, A-549, SH-SY5Y, Mouse testis, Rat testis