Rabbit anti-Human ERK1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12875P

• Product Name:
• Rabbit anti-Human ERK1 Polyclonal Antibody

• Synonym:
• ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK; K1

• Description:
• The antibody against ERK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ERK1 (NP_002737.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ERK1 (NP_002737.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ERK1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENV

• Gene ID:
• 5595

• Uniprot-ID:
• P27361

• Purification Method:
• Affinity purification

• Positive Samples:
• DU145, HeLa, 293T