Rabbit anti-Human ErbB4/HER4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09531P

• Product Name:
• Rabbit anti-Human ErbB4/HER4 Polyclonal Antibody

• Synonym:
• HER4; ALS19; p180erbB4; ErbB4/HER4

• Description:
• The antibody against ErbB4/HER4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1150-1250 of human ErbB4/HER4 (NP_005226.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1150-1250 of human ErbB4/HER4 (NP_005226.1).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ErbB4/HER4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPR

• Gene ID:
• 2066

• Uniprot-ID:
• Q15303

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat brain