Rabbit anti-Human ErbB3/HER3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05905P

• Product Name:
• Rabbit anti-Human ErbB3/HER3 Polyclonal Antibody

• Synonym:
• HER3; FERLK; LCCS2; VSCN1; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3; ErbB3/HER3

• Description:
• The antibody against ErbB3/HER3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-285 of human ErbB3/HER3 (NP_001973.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-285 of human ErbB3/HER3 (NP_001973.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ErbB3/HER3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGV

• Gene ID:
• 2065

• Uniprot-ID:
• P21860

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung, Rat skeletal muscle