Rabbit anti-Human EPHB2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08914P

• Product Name:
• Rabbit anti-Human EPHB2 Polyclonal Antibody

• Synonym:
• DRT; EK5; ERK; CAPB; Hek5; PCBC; EPHT3; Tyro5; BDPLT22; EPHB2

• Description:
• The antibody against EPHB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-540 of human EPHB2 (NP_059145.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 250-540 of human EPHB2 (NP_059145.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• EPHB2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEK

• Gene ID:
• 2048

• Uniprot-ID:
• P29323

• Purification Method:
• Affinity purification

• Positive Samples:
• NCI-H460, HepG2, HeLa, HT-1080, SW620, Mouse brain, Mouse heart